PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S11906.10
Common NameJCGZ_10561
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 199aa    MW: 22531.3 Da    PI: 6.3828
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S11906.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.35.3e-2689142255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    p lrWt+ LH+rFv+ ve LGGse+A P ++l lm+v++Ltl++vkSHLQ+YR+
  Jcr4S11906.10  89 PGLRWTTSLHARFVHSVELLGGSERASPMSVLCLMDVPDLTLAQVKSHLQMYRT 142
                    569**************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-1286145IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-2387144IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-1890142IPR006447Myb domain, plants
PfamPF068399.9E-7153196IPR010666Zinc finger, GRF-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MDCFVFHEEN SVQTHPATSL STTDTFSSAT NSVSLNSFSY SNSTPDYSLT IDTAESCTGS  60
VEEEVQAPAE FYKSFPSSPI LKQRSMRAPG LRWTTSLHAR FVHSVELLGG SERASPMSVL  120
CLMDVPDLTL AQVKSHLQMY RTVKQQELMK PRFCHCGTPC WVRTSRTEWN PGWKFVACEN  180
RKHDRSQGCD YFEWIDPVI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012075812.11e-99PREDICTED: transcription factor BOA-like
TrEMBLA0A067KF011e-146A0A067KF01_JATCU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.14e-30G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]